PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM10G16690.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 318aa    MW: 34835.7 Da    PI: 4.9146
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM10G16690.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.71.2e-4951221122
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      +ppGfrFhPtdeelv +yL+kkv+++k++l +vi++vd+y++ePwdL+   ++e++ewyfFs +d+ky+tg+r+nrat +g+Wkatg+dk+v +
  OGLUM10G16690.1   5 VPPGFRFHPTDEELVGYYLRKKVASQKIDL-DVIRDVDLYRIEPWDLQ--GYEEQSEWYFFSYKDRKYPTGTRTNRATMTGFWKATGRDKAVRE 95 
                      69****************************.9***************8..345789*************************************9 PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWv 122
                       +++l+g++ktLvfykgrap+g+ktdW+
  OGLUM10G16690.1  96 -RSRLIGMRKTLVFYKGRAPNGHKTDWI 122
                      .999***********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-503134IPR003441NAC domain
PROSITE profilePS5100547.7925155IPR003441NAC domain
PfamPF023654.1E-236122IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MESCVPPGFR FHPTDEELVG YYLRKKVASQ KIDLDVIRDV DLYRIEPWDL QGYEEQSEWY  60
FFSYKDRKYP TGTRTNRATM TGFWKATGRD KAVRERSRLI GMRKTLVFYK GRAPNGHKTD  120
WIEEGWVVCR AFKKRTMQPP RSSIGAWEAS YSYHDPAIFV GGGEHFKQET AAELDGVAAA  180
AGANAFLRYS TRLAELPQLE SPPLPSQGSQ AASAVVDGEE DNADSSRRPG GGGGAAAAVT  240
TDWRAFDKFV ASQLSPEEQH TCRATDDDDM AALLLLDGGG QEDDAGRWLG SAGLLSAVAA  300
DATTDCGLGT SCVPGDIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-43213612170Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0923890.0AC092389.4 Oryza sativa chromosome 10 BAC OSJNBa0053C23 genomic sequence, complete sequence.
GenBankAC1139480.0AC113948.5 Oryza sativa chromosome 10 BAC OSJNBb0038A07 genomic sequence, complete sequence.
GenBankAK1063130.0AK106313.1 Oryza sativa Japonica Group cDNA clone:002-101-D07, full insert sequence.
GenBankAP0149660.0AP014966.1 Oryza sativa Japonica Group DNA, chromosome 10, cultivar: Nipponbare, complete sequence.
GenBankJN6340730.0JN634073.1 Oryza sativa Japonica Group secondary wall NAC transcription factor 4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613865.10.0PREDICTED: NAC domain-containing protein 105
SwissprotO655082e-97NAC76_ARATH; NAC domain-containing protein 76
TrEMBLA0A0E0BD150.0A0A0E0BD15_9ORYZ; Uncharacterized protein
STRINGLOC_Os10g38834.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36253768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18060.16e-85vascular related NAC-domain protein 1